Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein automated matches [190118] (17 species) not a true protein |
Species Pseudozyma antarctica [TaxId:84753] [329779] (1 PDB entry) |
Domain d5knlb_: 5knl B: [329783] Other proteins in same PDB: d5knlc1, d5knlc2, d5knlf1, d5knlf2 automated match to d3wwqa_ complexed with so4 |
PDB Entry: 5knl (more details), 2.5 Å
SCOPe Domain Sequences for d5knlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5knlb_ d.15.1.1 (B:) automated matches {Pseudozyma antarctica [TaxId: 84753]} mqifvrtltgrtitlevessdtidnvrariqdregippdqqrlifagrqledgrtladyn iqrestlhlvlrlrgg
Timeline for d5knlb_: