Lineage for d5knle_ (5knl E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932413Protein automated matches [190118] (16 species)
    not a true protein
  7. 2932672Species Pseudozyma antarctica [TaxId:84753] [329779] (1 PDB entry)
  8. 2932674Domain d5knle_: 5knl E: [329780]
    Other proteins in same PDB: d5knlc1, d5knlc2, d5knlf1, d5knlf2
    automated match to d3wwqa_
    complexed with so4

Details for d5knle_

PDB Entry: 5knl (more details), 2.5 Å

PDB Description: crystal structure of s. pombe ubiquitin e1 (uba1) in complex with ubc15 and ubiquitin
PDB Compounds: (E:) Ubiquitin

SCOPe Domain Sequences for d5knle_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5knle_ d.15.1.1 (E:) automated matches {Pseudozyma antarctica [TaxId: 84753]}
mqifvrtltgrtitlevessdtidnvrariqdregippdqqrlifagrqledgrtladyn
iqrestlhlvlrlrgg

SCOPe Domain Coordinates for d5knle_:

Click to download the PDB-style file with coordinates for d5knle_.
(The format of our PDB-style files is described here.)

Timeline for d5knle_: