SCOPe 2.08: Domain d5knle_: 5knl E:

Lineage for d5knle_ (5knl E:)

1. Root: SCOPe 2.08
2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)
5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240
6. Protein automated matches [190118] (16 species)
   not a true protein
7. Species Pseudozyma antarctica [TaxId:84753] [329779] (1 PDB entry)
8. Domain d5knle_: 5knl E: [329780]
   Other proteins in same PDB: d5knlc1, d5knlc2, d5knlf1, d5knlf2
   automated match to d3wwqa_
   complexed with so4

Details for d5knle_

PDB Entry: 5knl, 2.5 Å

PDB Description: crystal structure of s. pombe ubiquitin e1 (uba1) in complex with ubc15 and ubiquitin

PDB Compounds: (E:) Ubiquitin

SCOPe Domain Sequences for d5knle_:

Sequence; same for both SEQRES and ATOM records:

>d5knle_ d.15.1.1 (E:) automated matches {Pseudozyma antarctica [TaxId: 84753]}
mqifvrtltgrtitlevessdtidnvrariqdregippdqqrlifagrqledgrtladyn
iqrestlhlvlrlrgg

SCOPe Domain Coordinates for d5knle_ are not available.

Timeline for d5knle_:

• d5knle_ first appeared in SCOPe 2.06
  
• d5knle_ appears in SCOPe 2.07