SCOPe 2.08: Domain d5grhb_: 5grh B:

Lineage for d5grhb_ (5grh B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.0: automated matches [191423] (1 protein)
   not a true family

6. Protein automated matches [190603] (25 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [329721] (12 PDB entries)

8. Domain d5grhb_: 5grh B: [329776]
   automated match to d3blxc_
   complexed with mg

Details for d5grhb_

PDB Entry: 5grh, 2.8 Å

PDB Description: crystal structure of the alpha gamma heterodimer of human idh3 in complex with mg(2+)

PDB Compounds: (B:) Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial

SCOPe Domain Sequences for d5grhb_:

Sequence; same for both SEQRES and ATOM records:

>d5grhb_ c.77.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grhtvtmipgdgigpelmlhvksvfrhacvpvdfeevhvssnadeedirnaimairrnrv
alkgnietnhnlppshksrnnilrtsldlyanvihckslpgvvtrhkdidilivrenteg
eysslehesvagvveslkiitkakslriaeyafklaqesgrkkvtavhkanimklgdglf
lqccrevaarypqitfenmivdnttmqlvsrpqqfdvmvmpnlygnivnnvcaglvggpg
lvaganyghvyavfetatrntgksianknianptatllascmmldhlklhsyatsirkav
lasmdnenmhtpdiggqgttseaiqdvirhirvin

Timeline for d5grhb_:

• d5grhb_ first appeared in SCOPe 2.06
  
• d5grhb_ appears in SCOPe 2.07