Lineage for d5grhb_ (5grh B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2906251Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2906252Protein automated matches [190603] (25 species)
    not a true protein
  7. 2906305Species Human (Homo sapiens) [TaxId:9606] [329721] (12 PDB entries)
  8. 2906321Domain d5grhb_: 5grh B: [329776]
    automated match to d3blxc_
    complexed with mg

Details for d5grhb_

PDB Entry: 5grh (more details), 2.8 Å

PDB Description: crystal structure of the alpha gamma heterodimer of human idh3 in complex with mg(2+)
PDB Compounds: (B:) Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial

SCOPe Domain Sequences for d5grhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5grhb_ c.77.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grhtvtmipgdgigpelmlhvksvfrhacvpvdfeevhvssnadeedirnaimairrnrv
alkgnietnhnlppshksrnnilrtsldlyanvihckslpgvvtrhkdidilivrenteg
eysslehesvagvveslkiitkakslriaeyafklaqesgrkkvtavhkanimklgdglf
lqccrevaarypqitfenmivdnttmqlvsrpqqfdvmvmpnlygnivnnvcaglvggpg
lvaganyghvyavfetatrntgksianknianptatllascmmldhlklhsyatsirkav
lasmdnenmhtpdiggqgttseaiqdvirhirvin

SCOPe Domain Coordinates for d5grhb_:

Click to download the PDB-style file with coordinates for d5grhb_.
(The format of our PDB-style files is described here.)

Timeline for d5grhb_: