SCOPe 2.08: Domain d5hxfa1: 5hxf A:2-182

Lineage for d5hxfa1 (5hxf A:2-182)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (36 species)
   not a true protein

7. Species Enterovirus a71 [TaxId:39054] [313489] (6 PDB entries)

8. Domain d5hxfa1: 5hxf A:2-182 [329761]
   Other proteins in same PDB: d5hxfa2
   automated match to d2vb0a_
   complexed with ag7, so4

Details for d5hxfa1

PDB Entry: 5hxf, 1.39 Å

PDB Description: crystal structure of 3c protease from a mild human enterovirus 71 in complex with rupintrivir

PDB Compounds: (A:) 3C protease

SCOPe Domain Sequences for d5hxfa1:

Sequence; same for both SEQRES and ATOM records:

>d5hxfa1 b.47.1.0 (A:2-182) automated matches {Enterovirus a71 [TaxId: 39054]}
gpsldfalsllrrnirqvqtdqghftmlgvrdrlavlprhsqpgktiwvehklvnvldav
elvdeqgvdleltlitldtnekfrditkfipenistasdatlvintehmpsmfvpvgdvv
qygflnlsgkpthrtmmynfptkagqcggvvtsvgkvvgihiggngrqgfcaglkrsyfa
s

Timeline for d5hxfa1:

• d5hxfa1 first appeared in SCOPe 2.06
  
• d5hxfa1 appears in SCOPe 2.07