Lineage for d5b1me_ (5b1m E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2312022Protein automated matches [193445] (8 species)
    not a true protein
  7. 2312431Species Mouse (Mus musculus) [TaxId:10090] [254907] (4 PDB entries)
  8. 2312445Domain d5b1me_: 5b1m E: [329760]
    automated match to d1eqzg_
    protein/DNA complex

Details for d5b1me_

PDB Entry: 5b1m (more details), 2.34 Å

PDB Description: the mouse nucleosome structure containing h3.1
PDB Compounds: (E:) Histone H3.1

SCOPe Domain Sequences for d5b1me_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1me_ a.22.1.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeac
eaylvglfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d5b1me_:

Click to download the PDB-style file with coordinates for d5b1me_.
(The format of our PDB-style files is described here.)

Timeline for d5b1me_: