![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
![]() | Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) ![]() the constituent families form similar dimers |
![]() | Family c.77.1.0: automated matches [191423] (1 protein) not a true family |
![]() | Protein automated matches [190603] (25 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [329721] (12 PDB entries) |
![]() | Domain d5grib_: 5gri B: [329750] automated match to d3blxc_ complexed with cit, mg |
PDB Entry: 5gri (more details), 2.31 Å
SCOPe Domain Sequences for d5grib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5grib_ c.77.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rhtvtmipgdgigpelmlhvksvfrhacvpvdfeevhvssnadeedirnaimairrnrva lkgnietnhnlppshksrnnilrtsldlyanvihckslpgvvtrhkdidilivrentege ysslehesvagvveslkiitkakslriaeyafklaqesgrkkvtavhkanimklgdglfl qccrevaarypqitfenmivdnttmqlvsrpqqfdvmvmpnlygnivnnvcaglvggpgl vaganyghvyavfetatrntgksianknianptatllascmmldhlklhsyatsirkavl asmdnenmhtpdiggqgttseaiqdvirhirving
Timeline for d5grib_: