![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
![]() | Protein Class alpha GST [81360] (8 species) |
![]() | Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (35 PDB entries) Uniprot P08263 |
![]() | Domain d1gule2: 1gul E:4-80 [32973] Other proteins in same PDB: d1gula1, d1gulb1, d1gulc1, d1guld1, d1gule1, d1gulf1, d1gulg1, d1gulh1 |
PDB Entry: 1gul (more details), 2.7 Å
SCOPe Domain Sequences for d1gule2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gule2 c.47.1.5 (E:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm klvqtrsilhyiadkhn
Timeline for d1gule2: