![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H4 [47125] (7 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [192456] (36 PDB entries) |
![]() | Domain d5gt0b_: 5gt0 B: [329716] Other proteins in same PDB: d5gt0c_, d5gt0d_, d5gt0g_, d5gt0h_ automated match to d1s32b_ protein/DNA complex; complexed with cl, mn |
PDB Entry: 5gt0 (more details), 2.82 Å
SCOPe Domain Sequences for d5gt0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gt0b_ a.22.1.1 (B:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]} dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta mdvvyalkrqgrtlygfgg
Timeline for d5gt0b_: