![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein automated matches [193445] (8 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [254907] (4 PDB entries) |
![]() | Domain d5b1mb_: 5b1m B: [329713] automated match to d1kx3f_ protein/DNA complex |
PDB Entry: 5b1m (more details), 2.34 Å
SCOPe Domain Sequences for d5b1mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b1mb_ a.22.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam dvvyalkrqgrtlygfgg
Timeline for d5b1mb_: