Lineage for d5gt3c_ (5gt3 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987252Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1987253Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1987254Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1987741Protein automated matches [193445] (6 species)
    not a true protein
  7. 1987820Species Human (Homo sapiens) [TaxId:9606] [193446] (46 PDB entries)
  8. 1987971Domain d5gt3c_: 5gt3 C: [329711]
    Other proteins in same PDB: d5gt3b_, d5gt3f_
    automated match to d2pyoc_
    protein/DNA complex; complexed with cl, mn

Details for d5gt3c_

PDB Entry: 5gt3 (more details), 2.91 Å

PDB Description: crystal structure of nucleosome particle in the presence of human testis-specific histone variant, hth2b
PDB Compounds: (C:) Histone H2A type 1-D

SCOPe Domain Sequences for d5gt3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gt3c_ a.22.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kaktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaard
nkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpk

SCOPe Domain Coordinates for d5gt3c_:

Click to download the PDB-style file with coordinates for d5gt3c_.
(The format of our PDB-style files is described here.)

Timeline for d5gt3c_: