Lineage for d5b1ld_ (5b1l D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987252Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1987253Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1987254Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1987741Protein automated matches [193445] (6 species)
    not a true protein
  7. 1987997Species Mouse (Mus musculus) [TaxId:10090] [254907] (3 PDB entries)
  8. 1988000Domain d5b1ld_: 5b1l D: [329699]
    automated match to d1kx5d_
    protein/DNA complex; complexed with cl, mn

Details for d5b1ld_

PDB Entry: 5b1l (more details), 2.35 Å

PDB Description: the mouse nucleosome structure containing h3t
PDB Compounds: (D:) Histone H2B type 3-A

SCOPe Domain Sequences for d5b1ld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1ld_ a.22.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
grkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiaseasrlahynkrstits
revqtavrlllpgelakhavsegtkavtkytss

SCOPe Domain Coordinates for d5b1ld_:

Click to download the PDB-style file with coordinates for d5b1ld_.
(The format of our PDB-style files is described here.)

Timeline for d5b1ld_: