![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein automated matches [193445] (8 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [254907] (4 PDB entries) |
![]() | Domain d5b1ld_: 5b1l D: [329699] automated match to d1kx5d_ protein/DNA complex; complexed with cl, mn |
PDB Entry: 5b1l (more details), 2.35 Å
SCOPe Domain Sequences for d5b1ld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b1ld_ a.22.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} grkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiaseasrlahynkrstits revqtavrlllpgelakhavsegtkavtkytss
Timeline for d5b1ld_: