SCOPe 2.06: Domain d5u6qb2: 5u6q B:111-200

Lineage for d5u6qb2 (5u6q B:111-200)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (24 PDB entries)

8. Domain d5u6qb2: 5u6q B:111-200 [329696]
   Other proteins in same PDB: d5u6qa1, d5u6qa2, d5u6qa3, d5u6qb1, d5u6qc1, d5u6qc2, d5u6qc3, d5u6qd1, d5u6qd2, d5u6qe1, d5u6qe2, d5u6qf_, d5u6qg1, d5u6qg2, d5u6qh_
   automated match to d2f54d2
   complexed with 7zs, act, gol, na

Details for d5u6qb2

PDB Entry: 5u6q, 1.9 Å

PDB Description: structure of human mr1-3-f-sa in complex with human mait a-f7 tcr

PDB Compounds: (B:) MAIT T-cell receptor alpha chain

SCOPe Domain Sequences for d5u6qb2:

Sequence, based on SEQRES records:

>d5u6qb2 b.1.1.2 (B:111-200) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

Sequence, based on observed residues (ATOM records):

>d5u6qb2 b.1.1.2 (B:111-200) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdsksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw
snksdfacanafnnsiipedtffpsp

Timeline for d5u6qb2:

• d5u6qb2 is new in SCOPe 2.06-stable
  
• d5u6qb2 appears in SCOPe 2.07
  
• d5u6qb2 appears in the current release, SCOPe 2.08