Lineage for d1gula2 (1gul A:4-80)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2876600Protein Class alpha GST [81360] (8 species)
  7. 2876613Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (35 PDB entries)
    Uniprot P08263
  8. 2876703Domain d1gula2: 1gul A:4-80 [32969]
    Other proteins in same PDB: d1gula1, d1gulb1, d1gulc1, d1guld1, d1gule1, d1gulf1, d1gulg1, d1gulh1

Details for d1gula2

PDB Entry: 1gul (more details), 2.7 Å

PDB Description: human glutathione transferase a4-4 complex with iodobenzyl glutathione
PDB Compounds: (A:) glutathione transferase a4-4

SCOPe Domain Sequences for d1gula2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
klvqtrsilhyiadkhn

SCOPe Domain Coordinates for d1gula2:

Click to download the PDB-style file with coordinates for d1gula2.
(The format of our PDB-style files is described here.)

Timeline for d1gula2: