Lineage for d5ti1f1 (5ti1 F:4-137)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784487Superfamily b.34.8: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63433] (2 families) (S)
    automatically mapped to Pfam PF09298
  5. 2784501Family b.34.8.0: automated matches [257687] (1 protein)
    not a true family
  6. 2784502Protein automated matches [257688] (2 species)
    not a true protein
  7. 2784508Species Burkholderia xenovorans [TaxId:266265] [329535] (1 PDB entry)
  8. 2784514Domain d5ti1f1: 5ti1 F:4-137 [329688]
    Other proteins in same PDB: d5ti1a2, d5ti1b2, d5ti1c2, d5ti1d2, d5ti1e2, d5ti1f2, d5ti1g2, d5ti1h2
    automated match to d4qkua1
    complexed with mg, na, no3, po4

Details for d5ti1f1

PDB Entry: 5ti1 (more details), 2 Å

PDB Description: crystal structure of fumarylacetoacetate hydrolase from burkholderia xenovorans lb400
PDB Compounds: (F:) fumarylacetoacetate hydrolase

SCOPe Domain Sequences for d5ti1f1:

Sequence, based on SEQRES records: (download)

>d5ti1f1 b.34.8.0 (F:4-137) automated matches {Burkholderia xenovorans [TaxId: 266265]}
ssdlqatldpsrkswvesannptgdfsiqnlpfgifsdglnatrrvgvaigdsivdlaal
esagllsvpstgagdsvfvrdalndfialgrdawrsvrvqlsrllsrddatlrddaelrg
ralirqadaqlhlp

Sequence, based on observed residues (ATOM records): (download)

>d5ti1f1 b.34.8.0 (F:4-137) automated matches {Burkholderia xenovorans [TaxId: 266265]}
ssdlqatldpsrkswvesannptgdfsiqnlpfgifsdglnatrrvgvaigdsivdlaal
esagllsvpsdsvfvrdalndfialgrdawrsvrvqlsrllsrddatlrddaelrgrali
rqadaqlhlp

SCOPe Domain Coordinates for d5ti1f1:

Click to download the PDB-style file with coordinates for d5ti1f1.
(The format of our PDB-style files is described here.)

Timeline for d5ti1f1: