Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
Domain d5u6qg2: 5u6q G:117-244 [329687] Other proteins in same PDB: d5u6qa1, d5u6qa3, d5u6qb2, d5u6qc1, d5u6qc3, d5u6qd2, d5u6qf_, d5u6qh_ automated match to d2vlme2 complexed with 7zs, act, gol, na |
PDB Entry: 5u6q (more details), 1.9 Å
SCOPe Domain Sequences for d5u6qg2:
Sequence, based on SEQRES records: (download)
>d5u6qg2 b.1.1.0 (G:117-244) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgra
>d5u6qg2 b.1.1.0 (G:117-244) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqnfrcqvqfyglsendewtqdrakpvtqivsaea wgra
Timeline for d5u6qg2: