SCOPe 2.06: Domain d5u6qg2: 5u6q G:117-244

Lineage for d5u6qg2 (5u6q G:117-244)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5u6qg2: 5u6q G:117-244 [329687]
   Other proteins in same PDB: d5u6qa1, d5u6qa3, d5u6qb2, d5u6qc1, d5u6qc3, d5u6qd2, d5u6qf_, d5u6qh_
   automated match to d2vlme2
   complexed with 7zs, act, gol, na

Details for d5u6qg2

PDB Entry: 5u6q, 1.9 Å

PDB Description: structure of human mr1-3-f-sa in complex with human mait a-f7 tcr

PDB Compounds: (G:) MAIT T-cell receptor beta chain

SCOPe Domain Sequences for d5u6qg2:

Sequence, based on SEQRES records:

>d5u6qg2 b.1.1.0 (G:117-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Sequence, based on observed residues (ATOM records):

>d5u6qg2 b.1.1.0 (G:117-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnfrcqvqfyglsendewtqdrakpvtqivsaea
wgra

Timeline for d5u6qg2:

• d5u6qg2 is new in SCOPe 2.06-stable
  
• d5u6qg2 appears in SCOPe 2.07
  
• d5u6qg2 appears in the current release, SCOPe 2.08