Lineage for d1gsfb2 (1gsf B:2-80)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168419Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 1168430Protein Class alpha GST [81360] (8 species)
  7. 1168450Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (19 PDB entries)
    Uniprot P08263
  8. 1168486Domain d1gsfb2: 1gsf B:2-80 [32968]
    Other proteins in same PDB: d1gsfa1, d1gsfb1, d1gsfc1, d1gsfd1
    complexed with eaa

Details for d1gsfb2

PDB Entry: 1gsf (more details), 2.7 Å

PDB Description: glutathione transferase a1-1 complexed with ethacrynic acid
PDB Compounds: (B:) glutathione transferase a1-1

SCOPe Domain Sequences for d1gsfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsfb2 c.47.1.5 (B:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

SCOPe Domain Coordinates for d1gsfb2:

Click to download the PDB-style file with coordinates for d1gsfb2.
(The format of our PDB-style files is described here.)

Timeline for d1gsfb2: