SCOPe 2.07: Domain d5tsrc_: 5tsr C:

Lineage for d5tsrc_ (5tsr C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)

6. Protein Protein tyrosine phosphatase type IVa [102418] (3 species)

7. Species Human (Homo sapiens), pr-3 [TaxId:9606] [102419] (4 PDB entries)
   Uniprot O75365 1-162 # 99% sequence identity

8. Domain d5tsrc_: 5tsr C: [329677]
   automated match to d2mbca_

Details for d5tsrc_

PDB Entry: 5tsr, 3.19 Å

PDB Description: crystal structure of prl-3 phosphatase in complex with the bateman domain of cnnm3 magnesium transporter

PDB Compounds: (C:) Protein tyrosine phosphatase type IVA 3

SCOPe Domain Sequences for d5tsrc_:

Sequence; same for both SEQRES and ATOM records:

>d5tsrc_ c.45.1.1 (C:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-3 [TaxId: 9606]}
nrpapvevsykhmrflithnptnatlstfiedlkkygattvvrvcevtydktplekdgit
vvdwpfddgapppgkvvedwlslvkakfceapgscvavhavaglgrapvlvalaliesgm
kyedaiqfirqkrrgainskqltylekyrpkqrl

Timeline for d5tsrc_:

• d5tsrc_ first appeared in SCOPe 2.06
  
• d5tsrc_ appears in the current release, SCOPe 2.08