SCOPe 2.08: Domain d5tlkg2: 5tlk G:111-215

Lineage for d5tlkg2 (5tlk G:111-215)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d5tlkg2: 5tlk G:111-215 [329659]
   Other proteins in same PDB: d5tlka1, d5tlkb_, d5tlkc1, d5tlkd_, d5tlke1, d5tlkf_, d5tlkg1, d5tlkh_
   automated match to d1dn0a2

Details for d5tlkg2

PDB Entry: 5tlk, 2.7 Å

PDB Description: complex between human cd27 and fab fragments of antibodies m2177 and h2191

PDB Compounds: (G:) h2191 light chain

SCOPe Domain Sequences for d5tlkg2:

Sequence; same for both SEQRES and ATOM records:

>d5tlkg2 b.1.1.2 (G:111-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d5tlkg2:

• d5tlkg2 first appeared in SCOPe 2.06
  
• d5tlkg2 appears in SCOPe 2.07