SCOPe 2.08: Domain d5tlkg1: 5tlk G:1-110

Lineage for d5tlkg1 (5tlk G:1-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5tlkg1: 5tlk G:1-110 [329658]
   Other proteins in same PDB: d5tlka2, d5tlkc2, d5tlkd_, d5tlke2, d5tlkg2, d5tlkh_
   automated match to d1dn0a1

Details for d5tlkg1

PDB Entry: 5tlk, 2.7 Å

PDB Description: complex between human cd27 and fab fragments of antibodies m2177 and h2191

PDB Compounds: (G:) h2191 light chain

SCOPe Domain Sequences for d5tlkg1:

Sequence; same for both SEQRES and ATOM records:

>d5tlkg1 b.1.1.0 (G:1-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspsslsasvgdrvtitcrasksvsegrwsfmhwyqqkpgkapklliyvasrles
gvpsrfsgsgsgtdftftisslqpediatyycqhsrelpwtfgqgtkvei

Timeline for d5tlkg1:

• d5tlkg1 first appeared in SCOPe 2.06
  
• d5tlkg1 appears in SCOPe 2.07