![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.5: Penicillin binding protein 2a (PBP2A), N-terminal domain [82595] (1 protein) some sequence similarity to KSI automatically mapped to Pfam PF05223 |
![]() | Protein Penicillin binding protein 2a (PBP2A), N-terminal domain [82596] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [82597] (10 PDB entries) Uniprot O54286 27-668 |
![]() | Domain d5m19a1: 5m19 A:27-138 [329655] Other proteins in same PDB: d5m19a2, d5m19a3, d5m19b2, d5m19b3 automated match to d1vqqa1 complexed with cd, mur |
PDB Entry: 5m19 (more details), 2 Å
SCOPe Domain Sequences for d5m19a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m19a1 d.17.4.5 (A:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]} dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk
Timeline for d5m19a1: