| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein T-cell antigen receptor [49125] (7 species) |
| Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries) |
| Domain d5u6qd2: 5u6q D:111-200 [329651] Other proteins in same PDB: d5u6qa1, d5u6qa2, d5u6qa3, d5u6qb1, d5u6qc1, d5u6qc2, d5u6qc3, d5u6qd1, d5u6qe1, d5u6qe2, d5u6qf_, d5u6qg1, d5u6qg2, d5u6qh_ automated match to d2f54d2 complexed with 7zs, act, gol, na missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 5u6q (more details), 1.9 Å
SCOPe Domain Sequences for d5u6qd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u6qd2 b.1.1.2 (D:111-200) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp
Timeline for d5u6qd2: