Lineage for d5u6qd1 (5u6q D:1-110)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755575Domain d5u6qd1: 5u6q D:1-110 [329650]
    Other proteins in same PDB: d5u6qa1, d5u6qa3, d5u6qb2, d5u6qc1, d5u6qc3, d5u6qd2, d5u6qf_, d5u6qh_
    automated match to d2f54d1
    complexed with 7zs, act, gol, na

Details for d5u6qd1

PDB Entry: 5u6q (more details), 1.9 Å

PDB Description: structure of human mr1-3-f-sa in complex with human mait a-f7 tcr
PDB Compounds: (D:) MAIT T-cell receptor alpha chain

SCOPe Domain Sequences for d5u6qd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u6qd1 b.1.1.0 (D:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrf
ssflsrskgysylllkelqmkdsasylcavkdsnyqliwgagtkliikpd

SCOPe Domain Coordinates for d5u6qd1:

Click to download the PDB-style file with coordinates for d5u6qd1.
(The format of our PDB-style files is described here.)

Timeline for d5u6qd1: