Lineage for d5u6qc2 (5u6q C:179-269)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755574Domain d5u6qc2: 5u6q C:179-269 [329647]
    Other proteins in same PDB: d5u6qa1, d5u6qa3, d5u6qb2, d5u6qc1, d5u6qc3, d5u6qd2, d5u6qf_, d5u6qh_
    automated match to d4l4va2
    complexed with 7zs, act, gol, na

Details for d5u6qc2

PDB Entry: 5u6q (more details), 1.9 Å

PDB Description: structure of human mr1-3-f-sa in complex with human mait a-f7 tcr
PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d5u6qc2:

Sequence, based on SEQRES records: (download)

>d5u6qc2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasieldpqssnlyschvehsgvhmvlqv

Sequence, based on observed residues (ATOM records): (download)

>d5u6qc2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgtyqawasield
pqssnlyschvehsgvhmvlqv

SCOPe Domain Coordinates for d5u6qc2:

Click to download the PDB-style file with coordinates for d5u6qc2.
(The format of our PDB-style files is described here.)

Timeline for d5u6qc2: