| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
| Protein automated matches [226842] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
| Domain d5u6qc1: 5u6q C:1-178 [329646] Other proteins in same PDB: d5u6qa2, d5u6qa3, d5u6qb1, d5u6qb2, d5u6qc2, d5u6qc3, d5u6qd1, d5u6qd2, d5u6qe1, d5u6qe2, d5u6qf_, d5u6qg1, d5u6qg2, d5u6qh_ automated match to d4l4va1 complexed with 7zs, act, gol, na |
PDB Entry: 5u6q (more details), 1.9 Å
SCOPe Domain Sequences for d5u6qc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u6qc1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d5u6qc1: