Lineage for d5tlka2 (5tlk A:111-215)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752917Domain d5tlka2: 5tlk A:111-215 [329641]
    Other proteins in same PDB: d5tlka1, d5tlkb_, d5tlkc1, d5tlkd_, d5tlke1, d5tlkf_, d5tlkg1, d5tlkh_
    automated match to d1dn0a2

Details for d5tlka2

PDB Entry: 5tlk (more details), 2.7 Å

PDB Description: complex between human cd27 and fab fragments of antibodies m2177 and h2191
PDB Compounds: (A:) m2177 light chain

SCOPe Domain Sequences for d5tlka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tlka2 b.1.1.2 (A:111-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d5tlka2:

Click to download the PDB-style file with coordinates for d5tlka2.
(The format of our PDB-style files is described here.)

Timeline for d5tlka2: