Lineage for d5u08d_ (5u08 D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209749Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2209750Protein automated matches [190038] (42 species)
    not a true protein
  7. 2210073Species Uncultured bacterium [TaxId:77133] [314792] (3 PDB entries)
  8. 2210079Domain d5u08d_: 5u08 D: [329637]
    automated match to d5hmnc_
    complexed with act, ca, mg, sis

Details for d5u08d_

PDB Entry: 5u08 (more details), 1.52 Å

PDB Description: crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample in complex with sisomicin
PDB Compounds: (D:) aac3-I

SCOPe Domain Sequences for d5u08d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u08d_ d.108.1.0 (D:) automated matches {Uncultured bacterium [TaxId: 77133]}
nflkierlaendlpkfiqlirlfeavfemknfsipdsehlqkllnqnnfyvfvallenki
vggltsyvleqyysekplayiydlavdtnwqrqgigkklitatnqfytekgfeevfvqad
kvddyaldfarstkptaeeqvvhfyytlk

SCOPe Domain Coordinates for d5u08d_:

Click to download the PDB-style file with coordinates for d5u08d_.
(The format of our PDB-style files is described here.)

Timeline for d5u08d_: