![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (42 species) not a true protein |
![]() | Species Uncultured bacterium [TaxId:77133] [314792] (3 PDB entries) |
![]() | Domain d5u08d_: 5u08 D: [329637] automated match to d5hmnc_ complexed with act, ca, mg, sis |
PDB Entry: 5u08 (more details), 1.52 Å
SCOPe Domain Sequences for d5u08d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u08d_ d.108.1.0 (D:) automated matches {Uncultured bacterium [TaxId: 77133]} nflkierlaendlpkfiqlirlfeavfemknfsipdsehlqkllnqnnfyvfvallenki vggltsyvleqyysekplayiydlavdtnwqrqgigkklitatnqfytekgfeevfvqad kvddyaldfarstkptaeeqvvhfyytlk
Timeline for d5u08d_: