SCOP 1.75: Domain d1gsda2: 1gsd A:2-80

Lineage for d1gsda2 (1gsd A:2-80)

Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
Superfamily c.47.1: Thioredoxin-like [52833] (23 families)
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
Protein Class alpha GST [81360] (8 species)
Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (19 PDB entries)
Uniprot P08263
Domain d1gsda2: 1gsd A:2-80 [32963]
Other proteins in same PDB: d1gsda1, d1gsdb1, d1gsdc1, d1gsdd1

Details for d1gsda2

PDB Entry: 1gsd (more details), 2.5 Å

PDB Description: glutathione transferase a1-1 in unliganded form

PDB Compounds: (A:) glutathione transferase a1-1

SCOP Domain Sequences for d1gsda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsda2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

SCOP Domain Coordinates for d1gsda2:

Click to download the PDB-style file with coordinates for d1gsda2.
(The format of our PDB-style files is described here.)

Timeline for d1gsda2: