SCOPe 2.08: Domain d5u72d2: 5u72 D:111-200

Lineage for d5u72d2 (5u72 D:111-200)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries)

8. Domain d5u72d2: 5u72 D:111-200 [329615]
   Other proteins in same PDB: d5u72a1, d5u72a2, d5u72a3, d5u72b1, d5u72c1, d5u72c2, d5u72c3, d5u72d1, d5u72e1, d5u72e2, d5u72f_, d5u72g1, d5u72g2, d5u72h_
   automated match to d2f54d2
   complexed with 7zv, act, dms, gol
   missing some secondary structures that made up less than one-third of the common domain

Details for d5u72d2

PDB Entry: 5u72, 2.5 Å

PDB Description: structure of human mr1-5oh-dcf in complex with human mait a-f7 tcr

PDB Compounds: (D:) MAIT T-cell receptor alpha chain

SCOPe Domain Sequences for d5u72d2:

Sequence, based on SEQRES records:

>d5u72d2 b.1.1.2 (D:111-200) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

Sequence, based on observed residues (ATOM records):

>d5u72d2 b.1.1.2 (D:111-200) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsav
awsnksdfacanafnnsiipedtffpsp

Timeline for d5u72d2:

• d5u72d2 first appeared in SCOPe 2.06
  
• d5u72d2 appears in SCOPe 2.07