SCOPe 2.01: Domain d1gsea2: 1gse A:2-80

Lineage for d1gsea2 (1gse A:2-80)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (19 PDB entries)
   Uniprot P08263

8. Domain d1gsea2: 1gse A:2-80 [32961]
   Other proteins in same PDB: d1gsea1, d1gseb1
   complexed with bme, eaa, gsh; mutant

Details for d1gsea2

PDB Entry: 1gse, 2 Å

PDB Description: glutathione transferase a1-1 complexed with an ethacrynic acid glutathione conjugate (mutant r15k)

PDB Compounds: (A:) glutathione transferase

SCOPe Domain Sequences for d1gsea2:

Sequence; same for both SEQRES and ATOM records:

>d1gsea2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
aekpklhyfnargkmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

Timeline for d1gsea2:

• d1gsea2 first appeared (with stable ids) in SCOP 1.55
  
• d1gsea2 appears in SCOP 1.75
  
• d1gsea2 appears in SCOPe 2.02
  
• d1gsea2 appears in the current release, SCOPe 2.08