Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins) |
Protein Class mu GST [81359] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [52869] (2 PDB entries) |
Domain d1c72d2: 1c72 D:1-84 [32960] Other proteins in same PDB: d1c72a1, d1c72b1, d1c72c1, d1c72d1 complexed with epy |
PDB Entry: 1c72 (more details), 2.8 Å
SCOPe Domain Sequences for d1c72d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c72d2 c.47.1.5 (D:1-84) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp ylidgdvkltqsnailryiarkhn
Timeline for d1c72d2: