Lineage for d5ucqc_ (5ucq C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2060658Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2060659Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 2060750Protein automated matches [191079] (4 species)
    not a true protein
  7. 2060770Species Thermococcus thioreducens [TaxId:277988] [189009] (11 PDB entries)
  8. 2060792Domain d5ucqc_: 5ucq C: [329586]
    automated match to d3q5va_
    complexed with ca, edo, mrd, na, pop

Details for d5ucqc_

PDB Entry: 5ucq (more details), 1.4 Å

PDB Description: the structure of archaeal inorganic pyrophosphatase in complex with pyrophosphate
PDB Compounds: (C:) inorganic pyrophosphatase

SCOPe Domain Sequences for d5ucqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ucqc_ b.40.5.1 (C:) automated matches {Thermococcus thioreducens [TaxId: 277988]}
mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfg

SCOPe Domain Coordinates for d5ucqc_:

Click to download the PDB-style file with coordinates for d5ucqc_.
(The format of our PDB-style files is described here.)

Timeline for d5ucqc_: