Lineage for d1c72b2 (1c72 B:1-84)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484529Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2484752Protein Class mu GST [81359] (3 species)
  7. 2484753Species Chicken (Gallus gallus) [TaxId:9031] [52869] (2 PDB entries)
  8. 2484757Domain d1c72b2: 1c72 B:1-84 [32958]
    Other proteins in same PDB: d1c72a1, d1c72b1, d1c72c1, d1c72d1
    complexed with epy

Details for d1c72b2

PDB Entry: 1c72 (more details), 2.8 Å

PDB Description: tyr115, gln165 and trp209 contribute to the 1,2-epoxy-3-(p-nitrophenoxy)propane conjugating activities of glutathione s-transferase cgstm1-1
PDB Compounds: (B:) protein (glutathione s-transferase)

SCOPe Domain Sequences for d1c72b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c72b2 c.47.1.5 (B:1-84) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]}
vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
ylidgdvkltqsnailryiarkhn

SCOPe Domain Coordinates for d1c72b2:

Click to download the PDB-style file with coordinates for d1c72b2.
(The format of our PDB-style files is described here.)

Timeline for d1c72b2: