Lineage for d5u08c_ (5u08 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2575571Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2575572Protein automated matches [190038] (48 species)
    not a true protein
  7. 2576082Species Uncultured bacterium [TaxId:77133] [314792] (6 PDB entries)
  8. 2576087Domain d5u08c_: 5u08 C: [329562]
    automated match to d5hmnc_
    complexed with act, ca, mg, sis

Details for d5u08c_

PDB Entry: 5u08 (more details), 1.52 Å

PDB Description: crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample in complex with sisomicin
PDB Compounds: (C:) aac3-I

SCOPe Domain Sequences for d5u08c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u08c_ d.108.1.0 (C:) automated matches {Uncultured bacterium [TaxId: 77133]}
dnflkierlaendlpkfiqlirlfeavfemknfsipdsehlqkllnqnnfyvfvallenk
ivggltsyvleqyysekplayiydlavdtnwqrqgigkklitatnqfytekgfeevfvqa
dkvddyaldfarstkptaeeqvvhfyytlk

SCOPe Domain Coordinates for d5u08c_:

Click to download the PDB-style file with coordinates for d5u08c_.
(The format of our PDB-style files is described here.)

Timeline for d5u08c_: