SCOP 1.57: Domain d1gsub2: 1gsu B:1-84

Lineage for d1gsub2 (1gsu B:1-84)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins)

6. Protein Glutathione S-transferase [52863] (24 species)

7. Species Chicken (Gallus gallus), class mu [52869] (2 PDB entries)

8. Domain d1gsub2: 1gsu B:1-84 [32956]
   Other proteins in same PDB: d1gsua1, d1gsub1

Details for d1gsub2

PDB Entry: 1gsu, 1.94 Å

PDB Description: an avian class-mu glutathione s-transferase, cgstm1-1 at 1.94 angstrom resolution

SCOP Domain Sequences for d1gsub2:

Sequence; same for both SEQRES and ATOM records:

>d1gsub2 c.47.1.5 (B:1-84) Glutathione S-transferase {Chicken (Gallus gallus), class mu}
vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
ylidgdvkltqsnailryiarkhn

Timeline for d1gsub2:

• d1gsub2 first appeared (with stable ids) in SCOP 1.55
  
• d1gsub2 appears in SCOP 1.59
  
• d1gsub2 appears in the current release, SCOPe 2.08