Lineage for d5m4yc1 (5m4y C:36-223)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714459Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 2714477Superfamily a.47.2: t-snare proteins [47661] (1 family) (S)
  5. 2714478Family a.47.2.1: t-snare proteins [47662] (6 proteins)
  6. 2714502Protein automated matches [191190] (5 species)
    not a true protein
  7. 2714507Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [329508] (2 PDB entries)
  8. 2714509Domain d5m4yc1: 5m4y C:36-223 [329554]
    Other proteins in same PDB: d5m4ya2, d5m4yc2, d5m4ye2
    automated match to d1fioa_
    complexed with gol

Details for d5m4yc1

PDB Entry: 5m4y (more details), 2.2 Å

PDB Description: crystal structure of the sec3/sso2 complex at 2.20 angstrom resolution
PDB Compounds: (C:) Protein SSO2

SCOPe Domain Sequences for d5m4yc1:

Sequence, based on SEQRES records: (download)

>d5m4yc1 a.47.2.1 (C:36-223) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dfvafmnkinsinanlsryeniinqidaqhkdlltqvseeqemelrrslddyisqatdlq
yqlkadikdaqrdglhdsnkqaqaencrqkflkliqdyriidsnykeeskeqakrqytii
qpeatdeeveaaindvngqqifsqallnanrrgeaktalaevqarhqellklektmaelt
qlfndmee

Sequence, based on observed residues (ATOM records): (download)

>d5m4yc1 a.47.2.1 (C:36-223) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dfvafmnkinsinanlsryeniinqidaqhkdlltqvseeqemelrrslddyisqatdlq
yqlkadikdaqrdglhdsnkqaqaencrqkflkliqdyriidsnykeeskeqakrqytii
qpeatdeeveaaindvngqqirgeaktalaevqarhqellklektmaeltqlfndmee

SCOPe Domain Coordinates for d5m4yc1:

Click to download the PDB-style file with coordinates for d5m4yc1.
(The format of our PDB-style files is described here.)

Timeline for d5m4yc1: