Lineage for d1gsua2 (1gsu A:1-84)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484529Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2484752Protein Class mu GST [81359] (3 species)
  7. 2484753Species Chicken (Gallus gallus) [TaxId:9031] [52869] (2 PDB entries)
  8. 2484754Domain d1gsua2: 1gsu A:1-84 [32955]
    Other proteins in same PDB: d1gsua1, d1gsub1
    complexed with gtx

Details for d1gsua2

PDB Entry: 1gsu (more details), 1.94 Å

PDB Description: an avian class-mu glutathione s-transferase, cgstm1-1 at 1.94 angstrom resolution
PDB Compounds: (A:) class-mu glutathione s-transferase

SCOPe Domain Sequences for d1gsua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsua2 c.47.1.5 (A:1-84) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]}
vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
ylidgdvkltqsnailryiarkhn

SCOPe Domain Coordinates for d1gsua2:

Click to download the PDB-style file with coordinates for d1gsua2.
(The format of our PDB-style files is described here.)

Timeline for d1gsua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gsua1