| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Class mu GST [81359] (3 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [52869] (2 PDB entries) |
| Domain d1gsua2: 1gsu A:1-84 [32955] Other proteins in same PDB: d1gsua1, d1gsub1 complexed with gtx |
PDB Entry: 1gsu (more details), 1.94 Å
SCOPe Domain Sequences for d1gsua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gsua2 c.47.1.5 (A:1-84) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]}
vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
ylidgdvkltqsnailryiarkhn
Timeline for d1gsua2: