| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.8: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63433] (2 families) ![]() automatically mapped to Pfam PF09298 |
| Family b.34.8.0: automated matches [257687] (1 protein) not a true family |
| Protein automated matches [257688] (2 species) not a true protein |
| Species Burkholderia xenovorans [TaxId:266265] [329535] (1 PDB entry) |
| Domain d5ti1a1: 5ti1 A:4-137 [329542] Other proteins in same PDB: d5ti1a2, d5ti1b2, d5ti1c2, d5ti1d2, d5ti1e2, d5ti1f2, d5ti1g2, d5ti1h2 automated match to d4qkua1 complexed with mg, na, no3, po4 |
PDB Entry: 5ti1 (more details), 2 Å
SCOPe Domain Sequences for d5ti1a1:
Sequence, based on SEQRES records: (download)
>d5ti1a1 b.34.8.0 (A:4-137) automated matches {Burkholderia xenovorans [TaxId: 266265]}
ssdlqatldpsrkswvesannptgdfsiqnlpfgifsdglnatrrvgvaigdsivdlaal
esagllsvpstgagdsvfvrdalndfialgrdawrsvrvqlsrllsrddatlrddaelrg
ralirqadaqlhlp
>d5ti1a1 b.34.8.0 (A:4-137) automated matches {Burkholderia xenovorans [TaxId: 266265]}
ssdlqatldpsrkswvesannptgdfsiqnlpfgifsdglnatrrvgvaigdsivdlaal
esagllsvpdsvfvrdalndfialgrdawrsvrvqlsrllsrddatlrddaelrgralir
qadaqlhlp
Timeline for d5ti1a1: