Lineage for d5ti1d2 (5ti1 D:138-436)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004667Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 3004668Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. 3004772Family d.177.1.0: automated matches [191367] (1 protein)
    not a true family
  6. 3004773Protein automated matches [190444] (5 species)
    not a true protein
  7. 3004779Species Burkholderia xenovorans [TaxId:266265] [329537] (1 PDB entry)
  8. 3004783Domain d5ti1d2: 5ti1 D:138-436 [329540]
    Other proteins in same PDB: d5ti1a1, d5ti1b1, d5ti1c1, d5ti1d1, d5ti1e1, d5ti1f1, d5ti1g1, d5ti1h1
    automated match to d4qkud2
    complexed with mg, na, no3, po4

Details for d5ti1d2

PDB Entry: 5ti1 (more details), 2 Å

PDB Description: crystal structure of fumarylacetoacetate hydrolase from burkholderia xenovorans lb400
PDB Compounds: (D:) fumarylacetoacetate hydrolase

SCOPe Domain Sequences for d5ti1d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ti1d2 d.177.1.0 (D:138-436) automated matches {Burkholderia xenovorans [TaxId: 266265]}
vqipgytdfysskehatnvgsmfrdpknallpnwsempigyngrassvvvsgtpvrrpng
qlklpdqerpvfgacrkldieletgfvigagnalgepvtcadaeahifgmvllndwsard
iqqweyvplgpfnaktfattispwivtldalepfrvaqpaqdpqplaylrhdgehafdit
levtlrpqqakeastitrtnfkhmywtmaqqlahhtvsgcntrvgdlmgsgtisgpteds
fgslleltwngkkplelreggtrsfiedgdeltlagwcqgegyrvgfgvcageilpalk

SCOPe Domain Coordinates for d5ti1d2:

Click to download the PDB-style file with coordinates for d5ti1d2.
(The format of our PDB-style files is described here.)

Timeline for d5ti1d2: