| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Class mu GST [81359] (3 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [52868] (16 PDB entries) |
| Domain d1gscd2: 1gsc D:1-84 [32954] Other proteins in same PDB: d1gsca1, d1gscb1, d1gscc1, d1gscd1 CA-atoms only |
PDB Entry: 1gsc (more details), 2.5 Å
SCOPe Domain Sequences for d1gscd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gscd2 c.47.1.5 (D:1-84) Class mu GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh
Timeline for d1gscd2: