Lineage for d1gscd2 (1gsc D:1-84)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 244778Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 244779Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 244918Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)
  6. 245016Protein Class mu GST [81359] (3 species)
  7. 245050Species Rat (Rattus norvegicus) [TaxId:10116] [52868] (14 PDB entries)
  8. 245082Domain d1gscd2: 1gsc D:1-84 [32954]
    Other proteins in same PDB: d1gsca1, d1gscb1, d1gscc1, d1gscd1
    CA-atoms only

Details for d1gscd2

PDB Entry: 1gsc (more details), 2.5 Å

PDB Description: new crystal forms of a mu class glutathione s-transferase from rat liver

SCOP Domain Sequences for d1gscd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gscd2 c.47.1.5 (D:1-84) Class mu GST {Rat (Rattus norvegicus)}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

SCOP Domain Coordinates for d1gscd2:

Click to download the PDB-style file with coordinates for d1gscd2.
(The format of our PDB-style files is described here.)

Timeline for d1gscd2: