SCOPe 2.08: Domain d5ti1d1: 5ti1 D:4-137

Lineage for d5ti1d1 (5ti1 D:4-137)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.8: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63433] (2 families)
   automatically mapped to Pfam PF09298

5. Family b.34.8.0: automated matches [257687] (1 protein)
   not a true family

6. Protein automated matches [257688] (2 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [329535] (1 PDB entry)

8. Domain d5ti1d1: 5ti1 D:4-137 [329539]
   Other proteins in same PDB: d5ti1a2, d5ti1b2, d5ti1c2, d5ti1d2, d5ti1e2, d5ti1f2, d5ti1g2, d5ti1h2
   automated match to d4qkua1
   complexed with mg, na, no3, po4

Details for d5ti1d1

PDB Entry: 5ti1, 2 Å

PDB Description: crystal structure of fumarylacetoacetate hydrolase from burkholderia xenovorans lb400

PDB Compounds: (D:) fumarylacetoacetate hydrolase

SCOPe Domain Sequences for d5ti1d1:

Sequence, based on SEQRES records:

>d5ti1d1 b.34.8.0 (D:4-137) automated matches {Burkholderia xenovorans [TaxId: 266265]}
ssdlqatldpsrkswvesannptgdfsiqnlpfgifsdglnatrrvgvaigdsivdlaal
esagllsvpstgagdsvfvrdalndfialgrdawrsvrvqlsrllsrddatlrddaelrg
ralirqadaqlhlp

Sequence, based on observed residues (ATOM records):

>d5ti1d1 b.34.8.0 (D:4-137) automated matches {Burkholderia xenovorans [TaxId: 266265]}
ssdlqatldpsrkswvesannptgdfsiqnlpfgifsdglnatrrvgvaigdsivdlaal
esagllsvpsdsvfvrdalndfialgrdawrsvrvqlsrllsrddatlrddaelrgrali
rqadaqlhlp

Timeline for d5ti1d1:

• d5ti1d1 first appeared in SCOPe 2.06
  
• d5ti1d1 appears in SCOPe 2.07