| Class b: All beta proteins [48724] (180 folds) |
| Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) ![]() |
| Family b.11.1.0: automated matches [191607] (1 protein) not a true family |
| Protein automated matches [191109] (11 species) not a true protein |
| Species Methanosarcina acetivorans [TaxId:188937] [329445] (1 PDB entry) |
| Domain d5ht9b_: 5ht9 B: [329531] automated match to d3hz2a_ complexed with btb, mg, ni |
PDB Entry: 5ht9 (more details), 1.87 Å
SCOPe Domain Sequences for d5ht9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ht9b_ b.11.1.0 (B:) automated matches {Methanosarcina acetivorans [TaxId: 188937]}
naaevivyehvnfggksfdatsdqpgagdnlndkissikvksgtwrfyeyinyggrywdl
gpgeyssvesagipdnsissfrqi
Timeline for d5ht9b_: