Lineage for d5ht9b_ (5ht9 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773616Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 2773617Protein automated matches [191109] (11 species)
    not a true protein
  7. 2773690Species Methanosarcina acetivorans [TaxId:188937] [329445] (1 PDB entry)
  8. 2773692Domain d5ht9b_: 5ht9 B: [329531]
    automated match to d3hz2a_
    complexed with btb, mg, ni

Details for d5ht9b_

PDB Entry: 5ht9 (more details), 1.87 Å

PDB Description: crystal structure of m-crystallin in the presence of nickel
PDB Compounds: (B:) Beta/gama crystallin family protein

SCOPe Domain Sequences for d5ht9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ht9b_ b.11.1.0 (B:) automated matches {Methanosarcina acetivorans [TaxId: 188937]}
naaevivyehvnfggksfdatsdqpgagdnlndkissikvksgtwrfyeyinyggrywdl
gpgeyssvesagipdnsissfrqi

SCOPe Domain Coordinates for d5ht9b_:

Click to download the PDB-style file with coordinates for d5ht9b_.
(The format of our PDB-style files is described here.)

Timeline for d5ht9b_: