SCOP 1.75: Domain d1gscb2: 1gsc B:1-84

Lineage for d1gscb2 (1gsc B:1-84)

Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
Superfamily c.47.1: Thioredoxin-like [52833] (23 families)
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
Protein Class mu GST [81359] (3 species)
Species Rat (Rattus norvegicus) [TaxId:10116] [52868] (16 PDB entries)
Domain d1gscb2: 1gsc B:1-84 [32952]
Other proteins in same PDB: d1gsca1, d1gscb1, d1gscc1, d1gscd1
CA-atoms only

Details for d1gscb2

PDB Entry: 1gsc (more details), 2.5 Å

PDB Description: new crystal forms of a mu class glutathione s-transferase from rat liver

PDB Compounds: (B:) glutathione s-transferase

SCOP Domain Sequences for d1gscb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gscb2 c.47.1.5 (B:1-84) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

SCOP Domain Coordinates for d1gscb2:

Click to download the PDB-style file with coordinates for d1gscb2.
(The format of our PDB-style files is described here.)

Timeline for d1gscb2: