Lineage for d1gsca2 (1gsc A:1-84)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 584721Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 584855Protein Class mu GST [81359] (3 species)
  7. 584898Species Rat (Rattus norvegicus) [TaxId:10116] [52868] (16 PDB entries)
  8. 584929Domain d1gsca2: 1gsc A:1-84 [32951]
    Other proteins in same PDB: d1gsca1, d1gscb1, d1gscc1, d1gscd1

Details for d1gsca2

PDB Entry: 1gsc (more details), 2.5 Å

PDB Description: new crystal forms of a mu class glutathione s-transferase from rat liver

SCOP Domain Sequences for d1gsca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsca2 c.47.1.5 (A:1-84) Class mu GST {Rat (Rattus norvegicus)}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

SCOP Domain Coordinates for d1gsca2:

Click to download the PDB-style file with coordinates for d1gsca2.
(The format of our PDB-style files is described here.)

Timeline for d1gsca2: