SCOPe 2.08: Domain d5mace1: 5mac E:2-139

Lineage for d5mace1 (5mac E:2-139)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Methanococcoides burtonii [TaxId:29291] [329506] (1 PDB entry)

8. Domain d5mace1: 5mac E:2-139 [329507]
   Other proteins in same PDB: d5maca2, d5macb2, d5macc2, d5macd2, d5mace2
   automated match to d3a13d1
   complexed with cap, cl, mg

Details for d5mace1

PDB Entry: 5mac, 2.6 Å

PDB Description: crystal structure of decameric methanococcoides burtonii rubisco complexed with 2-carboxyarabinitol bisphosphate

PDB Compounds: (E:) Ribulose-1,5-bisphosphate carboxylase-oxygenase type III

SCOPe Domain Sequences for d5mace1:

Sequence; same for both SEQRES and ATOM records:

>d5mace1 d.58.9.0 (E:2-139) automated matches {Methanococcoides burtonii [TaxId: 29291]}
sliyedlvksldskqqayvdlklpdptngefllavfhmipggdlnvlqaaaeiaaesstg
tnikvstetafsrtmnarvyqldlerelvwiaypwrlfdrggnvqniltyiignilgmke
iqalklmdiwfppsmleq

Timeline for d5mace1:

• d5mace1 first appeared in SCOPe 2.06
  
• d5mace1 appears in SCOPe 2.07