Lineage for d5m18b1 (5m18 B:27-138)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2543841Family d.17.4.5: Penicillin binding protein 2a (PBP2A), N-terminal domain [82595] (1 protein)
    some sequence similarity to KSI
    automatically mapped to Pfam PF05223
  6. 2543842Protein Penicillin binding protein 2a (PBP2A), N-terminal domain [82596] (1 species)
  7. 2543843Species Staphylococcus aureus [TaxId:1280] [82597] (10 PDB entries)
    Uniprot O54286 27-668
  8. 2543853Domain d5m18b1: 5m18 B:27-138 [329501]
    Other proteins in same PDB: d5m18a2, d5m18a3, d5m18b2, d5m18b3
    automated match to d1vqqa1
    complexed with cd, mur

Details for d5m18b1

PDB Entry: 5m18 (more details), 1.98 Å

PDB Description: crystal structure of pbp2a from mrsa in the presence of cefepime ligand
PDB Compounds: (B:) Penicillin-binding protein 2

SCOPe Domain Sequences for d5m18b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m18b1 d.17.4.5 (B:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

SCOPe Domain Coordinates for d5m18b1:

Click to download the PDB-style file with coordinates for d5m18b1.
(The format of our PDB-style files is described here.)

Timeline for d5m18b1: