Lineage for d5jw9b_ (5jw9 B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3042247Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 3042395Superfamily h.4.17: occludin/ELL-like [144292] (2 families) (S)
    antiparallel hairpin with a kinked second helix; similar to the N-terminal structure of the thermostable carboxypeptidase 1 (82731)
  5. 3042402Family h.4.17.0: automated matches [329497] (1 protein)
    not a true family
  6. 3042403Protein automated matches [329498] (1 species)
    not a true protein
  7. 3042404Species Human (Homo sapiens) [TaxId:9606] [329499] (4 PDB entries)
  8. 3042405Domain d5jw9b_: 5jw9 B: [329500]
    automated match to d1wpaa1

Details for d5jw9b_

PDB Entry: 5jw9 (more details), 2 Å

PDB Description: the crystal structure of ell2 oclludin domain and aff4 peptide
PDB Compounds: (B:) RNA polymerase II elongation factor ELL2

SCOPe Domain Sequences for d5jw9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jw9b_ h.4.17.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpdylikyiaivsyeqrqnykddfnaeydeyralharmetvarrfikldaqrkrlspgsk
eyqnvheevlqeyqkikqsspnyheekyrceylhnklahikrmigefdqqqaesw

SCOPe Domain Coordinates for d5jw9b_:

Click to download the PDB-style file with coordinates for d5jw9b_.
(The format of our PDB-style files is described here.)

Timeline for d5jw9b_: