Lineage for d5jn5a2 (5jn5 A:192-304)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. Family c.84.1.0: automated matches [254314] (1 protein)
    not a true family
  6. Protein automated matches [254721] (4 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [316254] (14 PDB entries)
  8. Domain d5jn5a2: 5jn5 A:192-304 [329491]
    Other proteins in same PDB: d5jn5a4, d5jn5a5, d5jn5b4
    automated match to d5f9ca2
    complexed with ca, so4

Details for d5jn5a2

PDB Entry: 5jn5 (more details), 1.7500000000000002 Å

PDB Description: crystal structure of the d263y missense variant of human pgm1
PDB Compounds: (A:) Phosphoglucomutase-1

SCOPe Domain Sequences for d5jn5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jn5a2 c.84.1.0 (A:192-304) automated matches {Human (Homo sapiens) [TaxId: 9606]}
veayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavnc
vpledfgghhpypnltyaadlvetmksgehdfgaafdgdgdrnmilgkhgffv

SCOPe Domain Coordinates for d5jn5a2 are not available.

Timeline for d5jn5a2:

Domains from same chain:
(mouse over for more information)
d5jn5a1, d5jn5a3, d5jn5a4, d5jn5a5
Domains from other chains:
(mouse over for more information)
d5jn5b1, d5jn5b2, d5jn5b3, d5jn5b4