![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily) unusual fold |
![]() | Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) ![]() automatically mapped to Pfam PF03717 |
![]() | Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins) contains an insert subdomain of ClpS-like fold |
![]() | Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species) the insert subdomain (residues 168-239) is fully ordered |
![]() | Species Staphylococcus aureus [TaxId:1280] [82825] (10 PDB entries) Uniprot O54286 27-668 |
![]() | Domain d5m19b2: 5m19 B:139-327 [329483] Other proteins in same PDB: d5m19a1, d5m19a3, d5m19b1, d5m19b3 automated match to d1vqqa2 complexed with cd, mur |
PDB Entry: 5m19 (more details), 2 Å
SCOPe Domain Sequences for d5m19b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m19b2 d.175.1.1 (B:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]} dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgp inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk kdgkdiqlt
Timeline for d5m19b2: